Quantcast
Channel: ProperFoodie
Viewing all articles
Browse latest Browse all 25

Italian Tigella

$
0
0

Italian Tigella! The bestest snack we had in Italy last year. These plump little circles of bread are served warm with your choice of hams and cheeses . . . or a huge dollop of Nutella!. . .

NUTELLA TIGELLA!

Italian Tigella with cheese and ham filling

Nutella

Its February! and I have 3 reasons for Nutella consumption this month! The first, which is just around the corner, is World Nutella Day. Yep a whole day devoted to Nutella. The second is pancake day and even though I’m generally a honey and lemon kinda girl, there might be the odd dip in the Nutella jar. And of course the third is Valentines – and I guess consumption of any kind of chocolate in huge quantities is allowed on Valentines day 🙂

Valentines Tigella

Tigella

So now lets talk about Tigella!! NUTELLA TIGELLA. Ben and I were first introduced to the amazing Nutella Tigella in Bologna last year when we were honeymooning around Tuscany. We had never come across this type of Italian bread before, even though it was our 5th visit to Italy! I’m so glad that we decided to sit down and give them try.

debbie and ben at zerocinquantino in Bologna

ham and cheese tigella in Bologna

Not content with our basket full of savoury Tigella, we just had to try the Nutella Tigella as well.

nutella tigella in Bologna

Mmm, amazing!! So you know that I just had to give these a whirl myself at home – and World Nutella Day has forced me into action.

Tigella one with brie and ham and one with nutella

Homemade Italian Tigella

The Tigella is quite a basic bread dough, with the addition of a bit of butter. Its actually not a million miles away from my mini bread rolls recipe.

This dough needs to be left to rise (prove) twice, the first time for an hour and the second for 30 minutes, so you need at least an afternoon free to give these delightful little breads a go.

Tigella dough

Unlike the bread rolls, once this dough has risen once, it is then knocked back and rolled out. I rolled my dough to about half a cm in thickness and then cut out my Tigella circles with a 3 inch round cutter (a glass would do the same job).

Tigella dough cut into Tigella circles

These are then proved a second time before being baked for 10 minutes or until they puff up into little pillows – bellissimo! And so simple.

Tigella baked in the oven

Traditionally the Tigella is made in a metal clamp type instrument, which gives them their golden brown colour and imprints a pretty pattern on either side. As the Tigella implement isn’t cheap, I decided to improvise.

toastie maker tigella

Baking in the oven for 10 minutes means that the Tigella keep their round shape as they cook and then a quick blast in a toastie maker gives them a lovely golden finish. Although they literally need about 30 seconds in the toastie maker – any more and they dry out a little too much.

I cut mine open after they had baked in the oven and then quickly toasted before adding fillings.

Nutella first:

Nutella Tigella

and then plenty of ham and cheese:

Italian Tigella savoury and sweet

I’m thinking this would make such a lovely feast on Valentines Day 🙂

Nutritional info for this recipe

Italian Tigella

1 hour, 50 minutes

10 minutes

Total Time: 2 hours

Category: dessert, dinner

Cuisine: Italian

Serves 24

Serving Size: 1 Tigella

Calories per serving: 109 kcal

Fat per serving: 1.5g

Saturated fat per serving: 0.8g

Carbs per serving: 17.7g

Protein per serving: 7.3g

Sodium per serving: 80mg

Italian Tigella

Italian Tigella! The bestest snack we had in Italy last year. These plump little circles of bread are served warm with your choice of hams and cheeses . . . or a huge dollop of Nutella!

Ingredients

  • 500g 00 Flour
  • 200ml water
  • 100ml semi skimmed milk
  • 25g unsalted butter
  • 10g fresh yeast or 7g dried yeast
  • Pinch of sea salt
    Equipment
  • Large mixing bowl
  • Small pan for heating
  • 3 inch round cutter or upside down glass
  • Lightly oiled baking trays
  • Toastie machine if you wish to toast to a golden brown colour

Instructions

  • Mix the water and milk together in a small pan and heat until just warm (luke warm). Use your finger to test the temperature and stop heating as soon as the mixture feels slightly warm. Next dissolve the yeast in the milk and water and leave to activate for around 10 minutes.
  • Meanwhile melt the butter in a pan or in the microwave. Then sieve the flour into a large bowl and add the salt. Mix well with your fingers then make a well in the flour and pour in the melted butter. Start to mix the flour gradually with your fingers and then begin to add the milk mixture bit by bit. Add enough of the milk mix until the dough comes together. Turn the dough out onto a floured work surface and knead for 10 minutes or until smooth.
  • Lightly oil the bowl and place the kneaded dough in the centre then cover with cling film. Leave to prove (rise) for 1 hour.
  • After an hour turn out the dough and divide into 2 manageable pieces. Roll out one half to around half a cm thick. Using a 3 inch circular cutter or an upside down glass, cut circular shapes into the rolled dough. Gather up the left over dough, re-roll and cut out more circles. Repeat this with the second half of the dough.
  • Line up the dough tigella on lightly oiled baking trays and cover with a damp tea towel. Leave to rise for a second time for 30 minutes.
  • Pre heat oven to 180 degrees
  • After 30 minutes remove the tea towel and transfer the tigella to the oven and bake for 10 minutes.
  • Once baked, slice in half and add your favourite fillings. To add a touch of colour, place the tigella in a toastie maker for 30 seconds before adding the filling.
  • http://properfoodie.com/italian-tigella/

     

    Italian Tigella Breads
    I am linking this recipe to #cookblogshare hosted by hijackedbytwinsrecipesmadeeasyeverydayhealthyrecipes and Easypeasyfoodie. I am also linking to #brilliantblogposts by honestmum, #recipeoftheweek hosted by amummytoo, #BakingCrumbs hosted by onlycrumbsremain, and #CookOnceEatTwice hosted by seachingforspice.

    Cook Once Eat Twice
    Hijacked By Twins
    Brilliant blog posts on HonestMum.com
    Link up your recipe of the weekOnly Crumbs Remain

    The post Italian Tigella appeared first on Proper Foodie.


    Viewing all articles
    Browse latest Browse all 25

    Trending Articles